PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01036499001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family CO-like
Protein Properties Length: 439aa    MW: 47800.5 Da    PI: 6.6766
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01036499001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box20.88.3e-0791132439
           zf-B_box   4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39 
                        r+C+++ +   +++C+ ++ +lC+ C   +H        H++
  GSVIVT01036499001  91 RVCDTCRSAACTIYCRADSAYLCAGCDARIHAAnrvasqHER 132
                        79******99*********************65567777765 PP

2zf-B_box28.92.4e-09133177341
           zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41 
                         ++C+ +e+ ++ + C+ +   lC++C   +H+       H +vp
  GSVIVT01036499001 133 VWVCESCERAPAAFVCKADAASLCATCDADIHSAnplarrHHRVP 177
                        689*****************************6688999977766 PP

3CCT70.15.7e-24369412144
                CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                        Rea++lRY+eK+ktRkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  GSVIVT01036499001 369 REARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRT 412
                        9*****************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.09688135IPR000315B-box-type zinc finger
SMARTSM003361.5E-888135IPR000315B-box-type zinc finger
CDDcd000212.98E-591135No hitNo description
PROSITE profilePS5011910.993131178IPR000315B-box-type zinc finger
PfamPF006435.0E-7132177IPR000315B-box-type zinc finger
CDDcd000211.83E-7134178No hitNo description
SMARTSM003361.0E-9136178IPR000315B-box-type zinc finger
PfamPF062039.0E-18369411IPR010402CCT domain
PROSITE profilePS5101716.648369411IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 439 aa     Download sequence    Send to blast
MADTCLAPHL GAEFAFTSVA RNMESDACHS KGFSTTPTCL FRLPTVTSSP PFVHCAPETQ  60
TYAHSHSLTH MLKDEGCNAD AAAGGGGGWA RVCDTCRSAA CTIYCRADSA YLCAGCDARI  120
HAANRVASQH ERVWVCESCE RAPAAFVCKA DAASLCATCD ADIHSANPLA RRHHRVPVLP  180
IAGCLYGPPA TDPGGTEDED EAASWLLLNP VKNNNGSSNN QNNGLLFGGE VDEYLDLVEY  240
NSCPENQFSD QYNQQQPPPH YSVPHKNYGG DRVVPVQCGE AKGQLHQQHQ QQGFHLGMEY  300
ESSKAAYSYN PSISHSVSVS SMDVGVVPEA TTMSDISISI SHPRPPKGTI DLFSGPPIQM  360
PTQLTPMDRE ARVLRYREKK KTRKFEKTIR YASRKAYAET RPRIKGRFAK RTDVEVEVDQ  420
MFSTTLMAES GYGIVPSF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.19670.0bud| fruit| inflorescence| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4665850.0AM466585.1 Vitis vinifera contig VV78X276175.8, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002282509.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 2
SwissprotQ965021e-148COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
TrEMBLF6GVT30.0F6GVT3_VITVI; Putative uncharacterized protein
STRINGVIT_14s0083g00640.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.11e-111CONSTANS-like 2